Protein Info for GFF4231 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphate transport system permease protein PstC (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 42 to 65 (24 residues), see Phobius details amino acids 85 to 116 (32 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details amino acids 176 to 202 (27 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 34 to 325 (292 residues), 300.6 bits, see alignment E=5.1e-94 PF00528: BPD_transp_1" amino acids 112 to 321 (210 residues), 51.2 bits, see alignment E=6.7e-18

Best Hits

Swiss-Prot: 61% identical to PSTC_ECOLI: Phosphate transport system permease protein PstC (pstC) from Escherichia coli (strain K12)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 89% identity to vei:Veis_1292)

MetaCyc: 61% identical to phosphate ABC transporter membrane subunit PstC (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF4231 Phosphate transport system permease protein PstC (TC 3.A.1.7.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSVGTTMSSKSAPAESGNPSMVSIAKRQRIEDIVFHRLTQGFSLLVLVALMGIIISLFIN
AWPAFQKFGLGFVWRVEWDVVNEEFGAAIAIVGTLASAGIALLIAVPLAFGIALFLTENC
PVWLRRPLGTAVELLAAVPSIIYGMFGLFVFAPLFADYVQPGMQGLLGSMPLIGPLFGGA
TNGIGILAAGIVLAFMVLPFIAAVMRDVFEIVPPILRESAYGLGCTTWEVVRRVVLPYTQ
KGVIGGIMLGLGRALGETMAVTFVIGNANRLPTSLFSPGTSIASTLANEFGEAADFHLST
LFALGFLLFVITFIVLSAAKIMLLRAEKAKGL