Protein Info for GFF4230 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF12849: PBP_like_2" amino acids 26 to 310 (285 residues), 119.8 bits, see alignment E=9.2e-39 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 29 to 337 (309 residues), 381 bits, see alignment E=2e-118

Best Hits

Swiss-Prot: 52% identical to PSTS_RHILO: Phosphate-binding protein PstS (pstS) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 81% identity to vei:Veis_1293)

MetaCyc: 49% identical to phosphate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>GFF4230 Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MINKRIFLKTVAAAAMATAGMGSALAADITGAGASFPYPIYGKWAEAYKKETNVGLNYQS
IGSSGGIRQIKAKTVAFGATDAPVSGEDLDKDGMVQFPAIIGGTVPVINLEGFKPGELRV
TGPVLADMFLGTITKWNDPKLAALNPGKTLPDQAITVIHRSDGSGTTFNFTDYLATVSKD
WADKVGKGAAVKWPAASSVGGKGNEGVAANVSRVKGSVGYVEYAYTKKNNMPFLQLQNKD
GKYVSPDDKSFAAAAAGVNWFSVPGMGVSMVDAKGAESWPISTASFILMYKQPTDKAQSA
EVLKFFDWSFKSGKQMAADLDYVALPDSLTNEIRSKVWSQIQK