Protein Info for GFF4222 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 356 (333 residues), 131 bits, see alignment E=7.5e-42 PF00083: Sugar_tr" amino acids 62 to 195 (134 residues), 46.5 bits, see alignment E=3.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to sed:SeD_A0360)

Predicted SEED Role

"putative permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>GFF4222 putative permease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKNNIEETIGKYLPILMILPLAGLAELASLYSIQALLPKLSEVYNIPLNQVGMILSAEVG
FLALAMLFSGTLSDRFGRKPIIFYSLLAGGILTLLCATASSWPMLVVYRALLGIAVSGIT
AAVTVYISEEVSPALAGIVTGYFIFGNSLGSMSGRVFATLMMEHVSIDTIFFIFGGVLIA
MALAVKLFLPTSRQFVPTPSLQLGAVLKGGLEHFKNIRVSLCFVIGFILFGSFTSIFNFL
AFYLHRPPYELSYTWIGLIPVSFSLTFFLAPYAARVALNIGSMNALSMLIICMMVGAFLT
LIAPSLWVFISGIVLLSVAFFSAHSTVLAWVSSRSPNAKGQATSFYLLCYYSGGAVMGYL
NGYLFSWQGWNAIAASCLMMLGIGLFICRFIFAKYEKQPQIKKQSVQESF