Protein Info for PS417_21605 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 284 (274 residues), 81.6 bits, see alignment E=5.3e-27 amino acids 288 to 374 (87 residues), 36.9 bits, see alignment E=2.1e-13 PF00083: Sugar_tr" amino acids 39 to 151 (113 residues), 22.8 bits, see alignment E=4.2e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU4739)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TNB8 at UniProt or InterPro

Protein Sequence (461 amino acids)

>PS417_21605 MFS transporter (Pseudomonas simiae WCS417)
MRQIWKSFRALYFASLMMLIGSGLLSTYLALRLAADHVDSLWVGALMAANYFGLVLGGKI
GHRLIARVGHIRAYATCAGIVGAAVLGHGLVDWLPAWIVLRIIVGLGMMCQYMVIESWLN
EQADAKQRGVVFSGYMIASYLGLVLGQLILVMHPQLGLELLMLVALCFALCLVPVAMTRR
IHPAPLHPAPMEPRFFIKRVPQSLSTVLGAGLIVGSFYGLAPLYASQQGLTTEQVGLFMG
SCIFAGLVVQWPLGWLSDRYDRALLIRCFALCLAVAALPLAILTQVPLEVLFVAGFLCSL
VQFCLYPLAVAFSNDHVEGDRRVSLTAMLLVTYGVGASIGPLLAGVVMKLFGSQMLYAFF
SLCALILVWRIRPKAVTNLHQVDDAPLHHVAMPDSMSSSPLVAALDPRVDEAVVQEQMQT
AVPEPEPEAEPAPEVEEPAFVGPPEPVGPDEHPHDLSRARP