Protein Info for GFF4217 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, substrate-binding protein GltI (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 36 to 254 (219 residues), 64.8 bits, see alignment E=3.5e-22

Best Hits

Swiss-Prot: 50% identical to YHDW_ECO57: Putative amino-acid ABC transporter-binding protein YhdW (yhdW) from Escherichia coli O157:H7

KEGG orthology group: K09969, general L-amino acid transport system substrate-binding protein (inferred from 70% identity to bpt:Bpet0502)

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF4217 Glutamate/aspartate ABC transporter, substrate-binding protein GltI (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MKIVRIAAAMLLGICISGAATAGQTFDAVKKRGIVQCGVSTNLPGFAFTDSKGEWQGIDV
DTCRAIAAAMFGNASKFKVVPLTTQARFTALQSGEVDVLTRNTTQTMSRDTTLGLIGVGV
NFYDSQGIMVTKDANVTSARKLAGATICVLPGTTTELNLTDWFRGLKIEFKPVLLDTVDE
IKRAFVSGRCDGITMDKSQLALSRASFANAEKYLILPEALSKEPLGPMVRQGDEAWFNVV
RWTLNAMLEAEEYNLSSKNVDDVSKAAPPHIQRILGLSPGLGKGLGLDDKWAYNIIKQVG
NYGEIFDRSLGASSPMKLERGLNALYTRGGLMYGWPIR