Protein Info for GFF4213 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 169 (149 residues), 135.5 bits, E=2.1e-43

Best Hits

Swiss-Prot: 75% identical to AAPP_RHIL3: General L-amino acid transport ATP-binding protein AapP (aapP) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09972, general L-amino acid transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 84% identity to bpt:Bpet0505)

MetaCyc: 60% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Protein Sequence (246 amino acids)

>GFF4213 ABC transporter, ATP-binding protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MSDAIVSLQNVNKWYGDFHVLRNINLEVAKGERIVICGPSGSGKSTMIRCINRLEEHQSG
VIQVDGTELINDLRRIEAIRREVGMVFQHFNLFPHLTVLENLVLGPTWVLKQPLAQAEAL
AMKYLERVRIPDQAHKYPGQLSGGQQQRVAIARSLCMTPKIMLFDEPTSALDPEMVKEVL
DVMVSLALESRMTMLCVTHEMGFARKVADRVIFMDHGEIVEQGKPDQFFGNPQTDRARQF
LSQVVH