Protein Info for PS417_21580 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein CheW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01584: CheW
  • amino acids 21 to 155 (135 residues), 119.1 bits, E=1.2e-38
• PF00072: Response_reg
  • amino acids 181 to 299 (119 residues), 62.1 bits, E=5.4e-21

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 99% identity to pfs:PFLU4733)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

See A0A1N7U2U7 at UniProt or InterPro

Protein Sequence (310 amino acids)

>PS417_21580 chemotaxis protein CheW (Pseudomonas simiae WCS417)
MAGVMDSVNQRTQLVGQNRLELLLFRLDGKQLYGINVFKVREVLQCPKLTIMPKSSPVVC
GVANIRGATIPILDLALATGSAGLQDRESPFVIITEYNTKTQGFLVRSVERIVNMNWEEI
HPPPKGTGRDHYLTAVTRVDNQLVEIIDVEKILAEVAPTSETISVGVVDAETAHKAVSLR
VLTVDDSSVARKQVTRCLQTVGVEVVALNDGRQALDYLRKLVDDGKKPEEEFLMMISDIE
MPEMDGYTLTAEIRNDPRMQKLHIILHTSLSGVFNQAMVKKVGADDFLAKFRPDDLASRV
VDRIKAADHG