Protein Info for GFF4197 in Sphingobium sp. HT1-2

Annotation: Transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF00356: LacI" amino acids 14 to 59 (46 residues), 63.2 bits, see alignment 3e-21 PF13407: Peripla_BP_4" amino acids 82 to 321 (240 residues), 48.8 bits, see alignment E=1.4e-16 PF00532: Peripla_BP_1" amino acids 89 to 323 (235 residues), 60.8 bits, see alignment E=3.1e-20 PF13377: Peripla_BP_3" amino acids 182 to 338 (157 residues), 108.5 bits, see alignment E=8e-35

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 38% identity to psu:Psesu_0072)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF4197 Transcriptional regulator, LacI family (Sphingobium sp. HT1-2)
MRSTKDSPQGSDSTIADVAAAVGVSIRTVSRVLNQSPKVNAETRERVQKAIAALNFRPSM
RARAFAMGRSFLIGMVHNDRNALVLDAVQRGIVGEAGRRGYELVVHPTPMDAAASVEDVL
QFVRRSRTDGLVVLPPVSGIAGLPEALAREHIPAVALSALPITGYADVILSPEREAAAQV
AHYLLELGHRRIAMVGGPANAISAQERRAGFVEALAAAGVTLLDEAEGDYGFQSGLAAAE
RFLSLPTAPTAIFAANDVMAAGVLKCAGIKGVAVPQSLSVVGFDGSLLSHVVSPALTTIW
RPFGDMARIATQQLIDRIEGQAVTAELPPPLRLVEAESSGPVPA