Protein Info for GFF4197 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Regulator of sigma D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF04353: Rsd_AlgQ" amino acids 1 to 147 (147 residues), 171.7 bits, see alignment E=5.6e-55

Best Hits

Swiss-Prot: 100% identical to RSD_SALA4: Regulator of sigma D (rsd) from Salmonella agona (strain SL483)

KEGG orthology group: K07740, regulator of sigma D (inferred from 99% identity to spt:SPA4002)

MetaCyc: 89% identical to regulator of sigma D (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Regulator of sigma D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>GFF4197 Regulator of sigma D (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQS
LVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNC
LEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA