Protein Info for GFF419 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uncharacterized GST-like protein yibF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF13417: GST_N_3" amino acids 3 to 71 (69 residues), 45.4 bits, see alignment E=1.6e-15 PF02798: GST_N" amino acids 3 to 71 (69 residues), 31.9 bits, see alignment E=2.7e-11 PF13409: GST_N_2" amino acids 8 to 71 (64 residues), 52.8 bits, see alignment E=1e-17 PF00043: GST_C" amino acids 97 to 192 (96 residues), 53.3 bits, see alignment E=5.5e-18

Best Hits

Swiss-Prot: 87% identical to YIBF_ECOL6: Uncharacterized GST-like protein YibF (yibF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to see:SNSL254_A3962)

Predicted SEED Role

"Uncharacterized GST-like protein yibF" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>GFF419 Uncharacterized GST-like protein yibF (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLIGSYTSPFVRKISVLLLEKGITFEFINELPYEADNGVAQYNPLGKVPALVTEKGEYW
FDSPIIAEYIELLDIAPAMLPRDPMAALKVRQLEALADGIMDAALVSVREQARPTAQQSE
TELLRQREKINRSLDMLESYLSDGTLKTDTVNLATIAIACAVGYLNFRRVAPGWCVSRPH
LVKLVETLFQRESFARTEAPKA