Protein Info for GFF4189 in Pseudomonas sp. DMC3

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 269 (170 residues), 88.6 bits, see alignment E=2.3e-29

Best Hits

Swiss-Prot: 64% identical to TAUC_ECOLI: Taurine transport system permease protein TauC (tauC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 95% identity to pfo:Pfl01_0254)

MetaCyc: 64% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF4189 Putative aliphatic sulfonates transport permease protein SsuC (Pseudomonas sp. DMC3)
MSSYDVSAAAVKTPSVSIPVRRSLSTRWISLLTLFGLLAIWWAVTATGMIEPLFLPPPSA
VLQKGWLLATSGYMDSTLWQHLGASLSRIGLGLAFAILTAVPVGIAIGANRIARGVLDPL
IEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAIATATGVRTVDPAKLRAAQS
LGATRVQLIRHVILPSALPDILTGVRIGLGVGWSTLVAAELIAATSGLGFMVQSAAQFLV
TDVVVLGILVIALIAFTMEMGLRALQRRLVPWHGQAH