Protein Info for PS417_21450 in Pseudomonas simiae WCS417

Annotation: phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00182: fatty acid/phospholipid synthesis protein PlsX" amino acids 1 to 324 (324 residues), 324 bits, see alignment E=5.6e-101 PF02504: FA_synthesis" amino acids 1 to 315 (315 residues), 320.1 bits, see alignment E=1.5e-99 PF01515: PTA_PTB" amino acids 77 to 199 (123 residues), 24.9 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 97% identical to PLSX_PSEFS: Phosphate acyltransferase (plsX) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 97% identity to pfs:PFLU4707)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UG63 at UniProt or InterPro

Protein Sequence (326 amino acids)

>PS417_21450 phosphate acyltransferase (Pseudomonas simiae WCS417)
MGGDFGPRSIVQACIASLSATPSLHLTLVGQPSLLEELIASHPAVDRARLTITPASETIT
MDDKPAAALRGKPDSSMRVALELLRDGKVQACVSAGNTGALMALSRFVLKTLPGIDRPAM
VAAIPTQKGYCQLLDLGANVDCSAEHLFQFAVMGSVAAEALGVARPRVALLNIGTEDIKG
NQQVKLAATLLQGARGLNYIGFVEGDGLYRGEADVVVCDGFVGNILLKSSEGLATMIATR
IEALFKQNLASRLVGALALPLMRRLQADLAPARHNGASFLGLQGIVVKSHGSAGVEGFQS
AIARALIEIQENLPQRLHGRLEDLLP