Protein Info for GFF4182 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 50 to 75 (26 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details PF07885: Ion_trans_2" amino acids 66 to 136 (71 residues), 42.2 bits, see alignment E=2.9e-15

Best Hits

KEGG orthology group: None (inferred from 64% identity to xau:Xaut_2797)

Predicted SEED Role

"Ion transport 2 domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>GFF4182 hypothetical protein (Xanthobacter sp. DMC5)
MGTWMDGAFISGVLVSIVTISIQAMATLVVIKAVRYAARHLSGRRKVEALVIVMAASGTL
LTIAHLVEVMVWALLYSVTGATEPDNVYYFAFVNFTTLGYGDLIPARPWRILGPMTAANG
MLLFGWSTAVLFAVLSRSIAHLRLR