Protein Info for GFF4181 in Xanthobacter sp. DMC5

Annotation: GTP-binding protein TypA/BipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 TIGR00231: small GTP-binding protein domain" amino acids 1 to 139 (139 residues), 85 bits, see alignment E=5e-28 PF00009: GTP_EFTU" amino acids 2 to 194 (193 residues), 195.8 bits, see alignment E=1.7e-61 TIGR01394: GTP-binding protein TypA/BipA" amino acids 3 to 599 (597 residues), 903.2 bits, see alignment E=6.1e-276 PF22042: EF-G_D2" amino acids 211 to 288 (78 residues), 29.8 bits, see alignment E=1.6e-10 PF03144: GTP_EFTU_D2" amino acids 217 to 288 (72 residues), 45.7 bits, see alignment E=2.2e-15 PF00679: EFG_C" amino acids 397 to 481 (85 residues), 82.3 bits, see alignment E=6.2e-27 PF21018: BipA_C" amino acids 485 to 593 (109 residues), 156.1 bits, see alignment E=7.4e-50

Best Hits

Swiss-Prot: 51% identical to TYPA_HELPJ: GTP-binding protein TypA/BipA homolog (typA) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K06207, GTP-binding protein (inferred from 95% identity to xau:Xaut_2798)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>GFF4181 GTP-binding protein TypA/BipA (Xanthobacter sp. DMC5)
MKLRNIAIIAHVDHGKTTLVDELLKQSGSYRENQRVAERVMDSNDLEKERGITILAKATS
VVWKDTRINIVDTPGHADFGGEVERILNMVDGAIVLVDAAEGPMPQTKFVVGKALKIGLK
PIVAINKVDRSDARPTEVINEVFDLFAALDATDDQLDFPILYGSGRSGWMADSPEGPMDQ
GMAPLFDLVLKHVPEPTVDDGPFRMIGTLLEANPFLGRMITGRITSGSIKPNQAIKVLAQ
DGTLVEQGRVSKILAFRGIERQPIEEGVQGDIVAIAGLSKGTVADTFCALEVTEAMAAQP
IDPPTVTMSFIVNDSPLAGTEGDKVTSRVIRDRLFREAEGNVALKIEESTEKDSFFVSGR
GELQLAVLIETMRREGFELAVSRPRVVFQKDEATGQTLEPIEEVLIDVDEEYSGTVVQKM
SERRAEMIEMRPSGGNRQRLVFYAPTRGLIGYQSELLTDTRGTAIMNRLFHEYAPYRGEI
AGRTNGVLIANAAGEAVAYALWNLEDRGPMMIEPGWKVYQGMLIGVHNRDNDLEVNVLKG
KQLTNIRTTSKDEAVRLTPPIRMTLERALAWIQDDELVEVTPKSIRLRKRLLDPNDRKRE
ERKKESEMA