Protein Info for PS417_21395 in Pseudomonas simiae WCS417

Annotation: radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF04055: Radical_SAM" amino acids 15 to 174 (160 residues), 101.6 bits, see alignment E=8.3e-33 PF13353: Fer4_12" amino acids 17 to 80 (64 residues), 22.3 bits, see alignment E=2.1e-08 PF06463: Mob_synth_C" amino acids 180 to 307 (128 residues), 92.9 bits, see alignment E=2.4e-30

Best Hits

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 97% identity to pfs:PFLU4696)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0G4 at UniProt or InterPro

Protein Sequence (322 amino acids)

>PS417_21395 radical SAM protein (Pseudomonas simiae WCS417)
MIVDRQGRRFRNLRISLTSACNYACTYCVPNGKRLVAAQDELSAEAMARGVAYLIEAAGI
ERLRITGGEPLVSPKLEAFMGAVGQMGLSDISLTTNGQLLARKLPLLVEAGIKRINVSLD
TLDADAFRSIARGGDLATVLDGMDQARAAGIKIKVNMVPLRGQNLDQVMPLLEYCLARGY
ELRFIELMRMGHLAKDSNAFLQQFVSLQQLLGLIGEQHEYLQASAPIDATAVRYEIPGKG
YFGVIANESVPFCRTCSRLRLSSTGWLHGCLSSSNRHYVGDLLDKPRHQALPALQGLLMK
ALGDKQEVAFSGGATIMKIIGG