Protein Info for GFF4171 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Membrane fusion component of tripartite multidrug resistance system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF16576: HlyD_D23" amino acids 44 to 289 (246 residues), 67.7 bits, see alignment E=2.3e-22 PF13533: Biotin_lipoyl_2" amino acids 50 to 95 (46 residues), 45.6 bits, see alignment 1.2e-15 PF00529: CusB_dom_1" amino acids 85 to 336 (252 residues), 31 bits, see alignment E=5e-11 PF13437: HlyD_3" amino acids 214 to 333 (120 residues), 68.1 bits, see alignment E=2.6e-22

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 94% identity to ajs:Ajs_2921)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF4171 Membrane fusion component of tripartite multidrug resistance system (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAMPKKAKITSAVLLLAVAVGCVIYLNRPESSASTQSTDDAYVQADFTLVAPQVSGVIGK
VLVEENQPVKAGDLLVAIDDRDFIVAVNTAKAQVAAAEASVEGLAARVVQQETAIRQAQA
AVAVDDAELKLAEANQKRYRNLASDGSGSIQAQQQAEAQLAIRLASRDKNRAGLQAARQQ
TDILKADLEKAKAALSQAQAAQAAAELKLSYTQITAPISGVIGQKSVRVGSFVNAGKPLA
AVVPLDAVYITANFRETQLARVRPGQPVDIKVDALPGTELKGTVESLGPASGVSYSAVAP
HNATGNFTKIVQRLPVRIRIDSDQPDAANLRVGMSVTPKIRIGD