Protein Info for GFF4167 in Xanthobacter sp. DMC5

Annotation: 5,6-dimethylbenzimidazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02476: 5,6-dimethylbenzimidazole synthase
  • amino acids 7 to 211 (205 residues), 268.8 bits, E=1.2e-84
• PF00881: Nitroreductase
  • amino acids 19 to 186 (168 residues), 111 bits, E=3.6e-36

Best Hits

Swiss-Prot: 62% identical to BLUB_RHIME: 5,6-dimethylbenzimidazole synthase (bluB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04719, 5,6-dimethylbenzimidazole synthase [EC: 1.14.99.40] (inferred from 84% identity to xau:Xaut_2810)

MetaCyc: 62% identical to aerobic 5,6-dimethylbenzimidazole synthase (Sinorhizobium meliloti)
RXN-8771 [EC: 1.13.11.79]

Predicted SEED Role

"Cobalamin biosynthesis protein BluB @ 5,6-dimethylbenzimidazole synthase, flavin destructase family"

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (26/33 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (2/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.79 or 1.14.99.40

Protein Sequence (222 amino acids)

>GFF4167 5,6-dimethylbenzimidazole synthase (Xanthobacter sp. DMC5)
MVRDDSFSADERAAIYRCIAARRDVRRNFLPDPVPDAVLARVLAAGHAAPSVGFLQPWNF
IVVRSDETKAALHAAFSRANAEAAEMFEGERALLYRTLKLEGLREAPLLLCITCERDRAG
PVVLGRTHQSEMDIYSTVCAVQNIWLAARAENLGVGWVSILNLADLSRILAIPDPIVPVA
LLCMGYVDQFAATPDLERAGWRQRLPLEELVFSERFGEKVGT