Protein Info for GFF4167 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glutamate synthase [NADPH] small chain (EC 1.4.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 36 to 262 (227 residues), 167.1 bits, see alignment E=2.3e-53

Best Hits

Swiss-Prot: 94% identical to YPJD_ECOLI: Inner membrane protein YpjD (ypjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ses:SARI_00248)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF4167 Glutamate synthase [NADPH] small chain (EC 1.4.1.13) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPVFALLALVAYSFSLALIVPGLLQKNSGWRRMAILSAVIALVCHAVALESRILPGGDSG
QNLSLLNVGSLVSLMICTVMTIVASRNRGWLLLPIVYAFALINLAFATFMPNEYITHLEA
TPGMMVHIGLSLFSYATLIIAALYALQLAWIDYQLKNKKLAFSNEMPPLMSIERKMFHIT
QIGVVLLTLTLCTGLFYMHNLFSTENIDKAVLSIVAWFVYIVLLWGHYHEGWRGRRVVWF
NVAGAGILTLAYFGSRILQQFVS