Protein Info for PS417_21325 in Pseudomonas simiae WCS417

Annotation: arabinose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 248 to 292 (45 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 55 to 313 (259 residues), 121 bits, see alignment E=2.6e-39

Best Hits

Swiss-Prot: 62% identical to ARAH_ECOLI: L-arabinose transport system permease protein AraH (araH) from Escherichia coli (strain K12)

KEGG orthology group: K10538, L-arabinose transport system permease protein (inferred from 98% identity to pfs:PFLU4682)

MetaCyc: 62% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose transport system permease protein (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAQ3 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PS417_21325 arabinose ABC transporter permease (Pseudomonas simiae WCS417)
MSEVKTAKGFWPGFNQRKFLDDWVMLLAALSIFVLSALFIDNFLSPLNMRGLGLAISTVG
IAACTMLFCLASGHFDLSVGSVIACAGVVAGIVIRDTDSVVLGVSAALAMGLVVGLINGI
VIAKLRINALIATLATMQIVRGLAYIFSNGKAVGVMDEGFFVFGNGQLLGVPVPIIITVL
CFVFFGWLLNYTTYGRNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGLIGALAGVILASR
MTSGQPMIGQGFELTVISACVLGGVSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDTFY
QYVIRGSILLLAVIIDRMKQR