Protein Info for GFF4162 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA repair protein RecN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 TIGR00634: DNA repair protein RecN" amino acids 1 to 552 (552 residues), 565.4 bits, see alignment E=8.7e-174 PF02463: SMC_N" amino acids 2 to 510 (509 residues), 66 bits, see alignment E=3.6e-22 PF13476: AAA_23" amino acids 4 to 216 (213 residues), 55.2 bits, see alignment E=1.6e-18

Best Hits

Swiss-Prot: 92% identical to RECN_ECOLI: DNA repair protein RecN (recN) from Escherichia coli (strain K12)

KEGG orthology group: K03631, DNA repair protein RecN (Recombination protein N) (inferred from 100% identity to stt:t2638)

Predicted SEED Role

"DNA repair protein RecN" in subsystem DNA-replication or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>GFF4162 DNA repair protein RecN (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLAQLTISNFAIVRELEIDFQSGMTVITGETGAGKSIAIDALGLCLGGRAEADMVRTGAT
RADLCARFALKDTPAALRWLEENQLEEGRECLLRRVISSDGRSRGFINGTAVPLSQLREL
GQLLIQIHGQHAHQQLTKPEQQKSLLDSYANEAALAQQMAARYQLWHQSCRDLAHHQQQS
QERAARAELLQYQLKELNDFNPQAGEFEQIDEEYKRLANSGQLLTTSQNALALLADGEDV
NLQSQLYSAKQLVSELVGMDSKLSGILDMLEEATIQLTEASDELRHYCERLDLDPNRLFE
LEQRIAKQISLARKHHVSPEALPQLYQSLLEEQQQLDDQADSLETLTLAVNKHHQQALET
AQALHQQRQFYAQELGQLITESMHLLSMPHGLFTIDVKFDEHHLSNDGADRVEFKVTTNP
GQPLQPIAKVASGGELSRIALAIQVITARKMETPALIFDEVDVGISGPTAAVVGKLLRQL
GESTQVMCVTHLPQVAGCGHQHFFVSKETDGAMTETHMQPLDKRARLQELARLLGGSEVT
RNTLANAKELLAA