Protein Info for PS417_21315 in Pseudomonas simiae WCS417

Annotation: hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF08240: ADH_N" amino acids 28 to 146 (119 residues), 87.6 bits, see alignment E=6.4e-29 PF00107: ADH_zinc_N" amino acids 186 to 309 (124 residues), 76.7 bits, see alignment E=1.6e-25

Best Hits

Swiss-Prot: 52% identical to ADHC1_MYCS2: NADP-dependent alcohol dehydrogenase C 1 (adhc1) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K13979, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 95% identity to pfs:PFLU4680)

MetaCyc: 51% identical to 8-hydroxygeraniol dehydrogenase (Catharanthus roseus)
RXN-12961 [EC: 1.1.1.324]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1

Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.324

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UDR1 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PS417_21315 hydroxyacid dehydrogenase (Pseudomonas simiae WCS417)
MYTAIGYAAQSATTPLAPMSFQRRSPRADDVAIEILYCGVCHSDIHQARNEWGIAVYPLM
PGHEIVGKVTAVGANVTAHKVGDLVGVGCMVDSCRHCDACQADLEQYCLEGPTMTYATPD
RVDGSNTMGGYSDSIVVSEHFVVKIPAKLDLASAAPILCAGITTYSPLKHYGVKADDKVG
VLGMGGLGHMGIKFAKAMGAQVTLFTRSASKAEEGRRQGADHVIVSTDEAQMKAAAGSFD
FLLDTIPVQHDLNPYLDVLRFDGVHILVGLIEPVDPPVNAAKLVLGRKVLAGSLIGGIAE
TQEVLDFCAEHGITCDIEMLDIRHINEAYSRMIAGDVKYRFVIDMATLKA