Protein Info for GFF4160 in Sphingobium sp. HT1-2

Annotation: Ankyrin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF12796: Ank_2" amino acids 55 to 136 (82 residues), 44.3 bits, see alignment E=5.4e-15 amino acids 90 to 169 (80 residues), 49.3 bits, see alignment E=1.6e-16 PF00023: Ank" amino acids 73 to 104 (32 residues), 17.1 bits, see alignment 1.5e-06 amino acids 105 to 136 (32 residues), 21.6 bits, see alignment 5.1e-08 amino acids 139 to 169 (31 residues), 18.1 bits, see alignment 6.9e-07 PF13637: Ank_4" amino acids 115 to 158 (44 residues), 25.4 bits, see alignment 3.5e-09

Best Hits

KEGG orthology group: None (inferred from 76% identity to sjp:SJA_C1-00570)

Predicted SEED Role

"Ankyrin repeat protein chloroplast-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF4160 Ankyrin (Sphingobium sp. HT1-2)
MKIGMKSGLSTWLFLARPAAITLALMAPVAVQAQFSNNYNFLKAVKDADGDKATEMLQKP
GSTVINSRDVTTGETALHIVIGRRDTTWLNFMLSKGANPNLADNNGTTPLLLAVQNRFEE
GVRLLLARGAQVDKTNGSGETALIRAVQLRDIGLVRLLVAQGANADKRDTIAGMSARDYA
ERDSRTPGLVEALDSAKANAAAPKGPVQGPVF