Protein Info for GFF4148 in Xanthobacter sp. DMC5

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12840: HTH_20" amino acids 24 to 70 (47 residues), 39.6 bits, see alignment 2.5e-13 PF01022: HTH_5" amino acids 25 to 69 (45 residues), 49 bits, see alignment 2.8e-16 PF12802: MarR_2" amino acids 26 to 73 (48 residues), 37.5 bits, see alignment 1.3e-12 PF13489: Methyltransf_23" amino acids 150 to 300 (151 residues), 55 bits, see alignment E=5.1e-18 PF00891: Methyltransf_2" amino acids 151 to 262 (112 residues), 24.5 bits, see alignment E=9.6e-09 PF01209: Ubie_methyltran" amino acids 159 to 275 (117 residues), 50.5 bits, see alignment E=1.1e-16 PF05175: MTS" amino acids 161 to 262 (102 residues), 24.5 bits, see alignment E=1.1e-08 PF13847: Methyltransf_31" amino acids 163 to 264 (102 residues), 69.6 bits, see alignment E=1.5e-22 PF08241: Methyltransf_11" amino acids 164 to 260 (97 residues), 82.8 bits, see alignment E=1.3e-26 PF13649: Methyltransf_25" amino acids 164 to 256 (93 residues), 74.4 bits, see alignment E=5.7e-24 PF08242: Methyltransf_12" amino acids 164 to 258 (95 residues), 56.8 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 84% identity to xau:Xaut_2830)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>GFF4148 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (Xanthobacter sp. DMC5)
MSDRPLPAASSFAAVLEGLKAAGEDTRLRLVAVLGEAELTVSDLTEILGQSQPRISRHLK
LLADAGLVDRHREASWVFYRRAAEGPGGRIARSLLDLLDRDDPVLAGDRARLEAVRAARA
AAAQGYFAAHARQWDEIRRLHVPEAAVEAAVRRAFAGAPIRALLDLGTGTGRMLELFAPD
IERGMGVDLSPDMLGVARANLERAGVRNCLLRQSDIYAVPVPRDAFDAVIVHQVLHYLDD
GSRALKEAARVLAPGGRLLVVDFAPHGLEFLREAHAHRHLGFARATVEGWLAAAGLELVS
FDTLTPDGGAGDGLTVSLWLARDPRYVVADADLAHREIA