Protein Info for GFF4148 in Pseudomonas sp. DMC3

Annotation: Inner membrane protein YgaZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 48 to 93 (46 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 174 to 190 (17 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 219 to 235 (17 residues), see Phobius details PF03591: AzlC" amino acids 25 to 165 (141 residues), 130.1 bits, see alignment E=4e-42

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfo:Pfl01_0298)

Predicted SEED Role

"Branched-chain amino acid transport protein AzlC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF4148 Inner membrane protein YgaZ (Pseudomonas sp. DMC3)
MNERSGSAPLMATHQPSRTFAEASPVVAGYFTVSFVFGLMAVNAGLPMWLPVAMCLFVYA
GASQFAALALISSGASLTTIVLTTFLINARHMLMSVYMAKALRALGLSRMERWAYAGGLT
DESFAFHSVKLGTGAPVNVRYLIGFNLFCHTSWVLGGLLGAVCAQYAAHLIKYQLDYALT
AMMLYVLVSLCNTRNKLIAAAAAVVCMGALSLIGSSPFNVFIATFVGCGVGVCLTKRS