Protein Info for GFF4146 in Variovorax sp. SCN45

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR01851: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 4 to 307 (304 residues), 353.8 bits, see alignment E=4.3e-110 PF01118: Semialdhyde_dh" amino acids 40 to 99 (60 residues), 37.3 bits, see alignment E=3.4e-13 PF22698: Semialdhyde_dhC_1" amino acids 115 to 288 (174 residues), 107.8 bits, see alignment E=5.5e-35

Best Hits

Swiss-Prot: 66% identical to ARGC_BURCC: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Burkholderia cenocepacia (strain MC0-3)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 92% identity to vpe:Varpa_1710)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-, 1.2.1.38

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF4146 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) (Variovorax sp. SCN45)
MDLNIFIDGDQGTTGLDLQNRLRGGEFRIRTLPANLRKDAAARRAALNECDIAILCLPDA
AARDAVGMIENPSVRVIDASSAHRTSAGWVYGMPELDARQGERIASASRVTNPGCYPTAA
VALLRPLTDAGLLPADYPLVIHAVSGYSGQGRAGAEAHEAGAAGAGAHSLKVYGLALEHK
HVPEIEAYAGLAQRPVFVPAYGSYRQGIVLTIGLHARLLPAGVSGARIHECLGERYRDAA
HVRVKRMSSDAPVTELDPQVHNGSNDMSLAVACNERTGQIVLSAVLDNLGKGAAGAAVQN
LRLMTGVRALR