Protein Info for GFF4135 in Variovorax sp. SCN45

Annotation: Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 TIGR04022: sulfur acquisition oxidoreductase, SfnB family" amino acids 24 to 409 (386 residues), 486.2 bits, see alignment E=3.3e-150 PF02771: Acyl-CoA_dh_N" amino acids 43 to 136 (94 residues), 46.9 bits, see alignment E=6.6e-16 PF02770: Acyl-CoA_dh_M" amino acids 154 to 229 (76 residues), 35.4 bits, see alignment E=2e-12 PF00441: Acyl-CoA_dh_1" amino acids 254 to 384 (131 residues), 35.5 bits, see alignment E=2.3e-12 PF08028: Acyl-CoA_dh_2" amino acids 255 to 386 (132 residues), 48.7 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 48% identity to hse:Hsero_4755)

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>GFF4135 Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme (Variovorax sp. SCN45)
MSAVLASVSKRRAGHRTARAVQAAQVLRGDADALDTAHRIARLLADGAALRDRDRILPAQ
ELDVVSGAGLWAMNVPRVHGGAGVSYVTVAQVFAILSAADASIGQIQQNHNSAVFWLSTV
GTAAQKEFFLGEILRGCRFGNANVDAAGKQGAQPTVIARTARGHVLSGEKVYATGALFAH
YVTVIGQNEAGDKTVAIIPAGTPGLTIEDDWNSFGQRTTASGRVRLDRVELPELCVLPIH
RAYSEQAMGAVSQLSHVGIDLGIAQAALDDTVRFLRSGASITQPEGALRAVTDPLVISQV
GEIQVRLHAAAAMTQRAGLAVDAAVAVPDKARRAAASLAVAEAKWLTSEVALFASSKLFE
LCGTRSAQHPHAFDRHWRNARVHTLHDPVRHKLTVVGDALLNGVAPEGAGAL