Protein Info for PS417_21170 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details PF14235: DUF4337" amino acids 30 to 191 (162 residues), 132.9 bits, see alignment E=6e-43

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU4649)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TPF2 at UniProt or InterPro

Protein Sequence (192 amino acids)

>PS417_21170 membrane protein (Pseudomonas simiae WCS417)
MSEAFEVPSPHEKHLEHTTEHAHGRGDNFASRIAVMTALMATLGAMLSYQAGSTESEAAM
DKNNAAIIKTEAANQWNYYQAKSSRQNLAELATHIPGVDAAHYKDELERYKRQKEDVRKQ
AETLEATSKEWDEKSEQALHQHHRWAQAMTAIQIAISLAAITLLTRREWLKRLSYAAAGV
AVVLGSLAWLHI