Protein Info for GFF4133 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 transmembrane" amino acids 138 to 157 (20 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details amino acids 419 to 450 (32 residues), see Phobius details amino acids 723 to 740 (18 residues), see Phobius details amino acids 746 to 766 (21 residues), see Phobius details PF00403: HMA" amino acids 60 to 117 (58 residues), 49.3 bits, see alignment 8.1e-17 TIGR01511: copper-translocating P-type ATPase" amino acids 192 to 765 (574 residues), 441.4 bits, see alignment E=1.1e-135 TIGR01525: heavy metal translocating P-type ATPase" amino acids 209 to 765 (557 residues), 483.6 bits, see alignment E=2e-148 TIGR01494: HAD ATPase, P-type, family IC" amino acids 247 to 491 (245 residues), 126.9 bits, see alignment E=1.6e-40 amino acids 573 to 742 (170 residues), 105.5 bits, see alignment E=4.7e-34 PF00122: E1-E2_ATPase" amino acids 285 to 376 (92 residues), 85.5 bits, see alignment E=2.9e-28 PF00702: Hydrolase" amino acids 469 to 677 (209 residues), 86.7 bits, see alignment E=4.1e-28

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 58% identity to pol:Bpro_4307)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (768 amino acids)

>GFF4133 Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VPAPSPSTGEEAPPRADWLGTHRGALTVTDDFAILDDPVEQETFTRSLAPEGEAESVLVV
QGMYCAACADTVESVLQNLPGVQRAQVHAATRRLTLRWDPALTHLSSLARALGETGYRLL
PMQHALSVSERLRETRQALWRLFVAGFCMMQVMMYAWPAYVTAPGEIPPDITQLLRWASW
VISLPVVFFASGPFFASAWRDLKHGRVGMDTPVSIGILVTFIASSAATFDPSGPWGEEVW
FDSLTMFVFFLLGGRYLEHKARDRTAGALDGLMNRLPEVCERQKPGGGYESVSLRRLRVG
DTVRVHAGQAFPADGELLDDRATVDEALLTGESHPVSLQAGQGVVAGSFNLGGPVRVRVD
RIGPDTRFAQIVKLMERASTEKPRLAVLADRIAAPFLVFVLLAAVGAGFYWWQIDHTQAL
AVAVAVLIVTCPCALSLATPAAMLASAGALARRGVLVRRLQAFEALAGIDAVVFDKTGTL
THDRLALHEIRTRAGLDRAQALALAGALAEGSLHPVSRAISRETKEAGVDLAPLAGHTER
AGQGMQALRPDGSWVRLGSAAFCGIDPPAALSAGAPAVHLADAQGWLASFELQEGLRDDA
AAAVAALRSLGVQTWLLSGDREAPAQQVAAVVGVDHVIAGASPEQKLAEITALQARGLKV
AMVGDGLNDGPVLARADTSFALGHAAPLAQSQSDFIVQGGKVMDVVRTLGQARATLRTVR
QNLLWAGAYNVVCVPLALMGYMPPWLAGLGMAASSLLVIGNALRLARQ