Protein Info for GFF4130 in Xanthobacter sp. DMC5

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 54 to 77 (24 residues), see Phobius details amino acids 201 to 230 (30 residues), see Phobius details PF02518: HATPase_c" amino acids 398 to 509 (112 residues), 79.4 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: None (inferred from 84% identity to xau:Xaut_2850)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>GFF4130 Adaptive-response sensory-kinase SasA (Xanthobacter sp. DMC5)
MVAYVLTLIPSCNGPEGSGTGLPPVSDTMFEPRSHKPEEAPAPKRTRWSLGLSAKLLALT
VAVVATAEIAVLVPTIANYRIAWLSDRLAAARTAALVLDAAPQDGVTVDMTRELLDSVGA
KVIVVKREGTRRLLAASDMPPEADVHIDMRETTLWSAVHDAFDTLIADNGRILRIVGEPP
RGADFIEIVLSETPLRAALLRFAATVLLISLAVAVAAGVLVYVSLNWLFVRPMRRLTERM
SAFREDPEDASRIIVPSGRSDEIGTAEEALEELQRALSHTLHQKSHLAALGLAVSKINHD
LRNLLSSAQLLSDRLASVPDPTVQRFAPKLLAALDRAIHYCEQTLSYGRAKEPLPERRDV
ELAHLFEEVRETLGLSAGGSAGVGWVVDVERGLTADADPDQLFRVILNITRNALQALEAR
APLDPERDQIRVRARRKGPVVEIDLSDTGPGIPPARREHLFEAFVSSARRGGTGLGLPIA
DELVRAHGGHIHLLDTKIGTAFRITIPDQPESRHHRRERIRA