Protein Info for GFF412 in Sphingobium sp. HT1-2

Annotation: Bis-ABC ATPase YheS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 PF00005: ABC_tran" amino acids 23 to 175 (153 residues), 74.5 bits, see alignment E=4.6e-24 amino acids 325 to 456 (132 residues), 77.8 bits, see alignment E=4.6e-25 PF12848: ABC_tran_Xtn" amino acids 214 to 297 (84 residues), 93.1 bits, see alignment E=3.3e-30 PF13304: AAA_21" amino acids 418 to 483 (66 residues), 29.5 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 44% identical to YHES_ECOLI: Uncharacterized ABC transporter ATP-binding protein YheS (yheS) from Escherichia coli (strain K12)

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 92% identity to sch:Sphch_1563)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (622 amino acids)

>GFF412 Bis-ABC ATPase YheS (Sphingobium sp. HT1-2)
MLNLNGITVRLGGRTILDRAGAALPPRSRVGLIGRNGAGKSTLMKVMIGQLDPDEGSCDM
PRDTRLGYIAQEAPSGTATPFDTVLAADKERAALMAEAEHTEDPDRLGHIYERLTTIDAY
TAPARAARILVGLGFDEEMQGRPLDSYSGGWKMRVALAALLFSNPDLLLLDEPSNHLDLE
ATLWLENFLKAYRGTVVIISHERDLLNNVVDYILHLEGGKITLYPGGYDAFERQRAERLA
QQEAARAKQAAQREKLQDYVARNSARASTAKQAQSRAKALAKMQPIAAAIEDPSLHFGFP
SPAELRPPLITMDMASVGYDDTPILRRVNLRIDPDDRLALLGRNGNGKTTLARLIAAQLA
PMEGAINSSAKMNVGYFTQYQVEELDVTDTPLEHMTRVMKGATPGAVRAQLGRFGFSGER
ATQKVGSMSGGERARLALALITRDAPHLLILDEPTNHLDVDSREALVQALNEYSGAVVIV
SHDRHMIELVADRLVLVDNGTAQPFDGSLDDYTDIILRKADGNPSGGDAPKVDRKADKKA
AAEWREKQKTLKNAVNKAEREMSTLIAERKRIDAILSDPRSATGAEAKMTTSELMVKRAA
VEKKLEAAEEVWMEAGAALEAG