Protein Info for PS417_21095 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details amino acids 444 to 461 (18 residues), see Phobius details amino acids 467 to 488 (22 residues), see Phobius details PF14400: Transglut_i_TM" amino acids 25 to 184 (160 residues), 161 bits, see alignment E=2.4e-51 PF14402: 7TM_transglut" amino acids 260 to 505 (246 residues), 327.5 bits, see alignment E=5.5e-102

Best Hits

KEGG orthology group: None (inferred from 99% identity to pfs:PFLU4635)

Predicted SEED Role

"FIG139976: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7J4 at UniProt or InterPro

Protein Sequence (510 amino acids)

>PS417_21095 membrane protein (Pseudomonas simiae WCS417)
MRSLTLHLKILIAILVVLGISVTAYQIFVLGIPVTEDATDDLWNIDAKVEFVASPKDPVK
IQMFVPPLSRDFVSLNESFISNNYGVSVNRTDGNRKVTWSARRAKGNQTLYYRLVLTKRY
SGEKVKIKGPTFRDSIAVEGPEKIAAEALLAPIRQHSADVETFISEAIKRTNNLNDDNVK
LLLAGDPSTPHKAKIVELLLSIAHVPVEKVHTIRLVADQPQTPELWLRSFNGNDWLYFNP
ETGEQGLPADRLLWWTGDENLITVDGGKKATVTFSLNNSEMNAIRLAKLTDENTDANFLE
YSLYGLPLQTQQTFMIMVMIPIGVLVILILRNLIGLQTLGTFTPVLIALAFRETQLGFGI
VLFTIITALGLSLRSYLEHLKLQMLPRLSVVLTFVVVLIAAISLFSHKLGLERGLSVALF
PMVILTMTIERLSITWEERGANHALKVAIGTLFAASLAHLIMSVPELIYFVFTFPAILLI
LVGFMLAMGRYRGYRLTELVRFKAFLKADQ