Protein Info for GFF4118 in Sphingobium sp. HT1-2

Annotation: ATP-dependent helicase, DEAD/DEAH box family, associated with Flp pilus assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 9 to 794 (786 residues), 1074.4 bits, see alignment E=0 PF00270: DEAD" amino acids 22 to 190 (169 residues), 100.3 bits, see alignment E=2.6e-32 PF04851: ResIII" amino acids 30 to 188 (159 residues), 29.8 bits, see alignment E=1.3e-10 PF00271: Helicase_C" amino acids 246 to 344 (99 residues), 61.8 bits, see alignment E=1.8e-20 PF19306: WH_Lhr" amino acids 373 to 535 (163 residues), 152.1 bits, see alignment E=2.4e-48 PF08494: DEAD_assoc" amino acids 586 to 767 (182 residues), 163.9 bits, see alignment E=1e-51

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 88% identity to sch:Sphch_2267)

Predicted SEED Role

"ATP-dependent helicase, DEAD/DEAH box family, associated with Flp pilus assembly" in subsystem Widespread colonization island

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (803 amino acids)

>GFF4118 ATP-dependent helicase, DEAD/DEAH box family, associated with Flp pilus assembly (Sphingobium sp. HT1-2)
MPPVLPSILTDWFASRGWRVRRHQSDMLLAAQRGEHALLVAPTGAGKTLAGFLPTLADLI
GNPADGLHTLYVSPLKALAVDVRRNLLTPIEEMGLPIRVETRTGDTPSDRKARQRVRPPH
ILLTTPESLSLLLSYPDAALLFEHLRTVIVDEVHAFATQKRGDLLNLSMARLQAINPDLR
RVALSATVADVDAYRAWLAPDGDIDAVTPVLGEAGAEPDVTILIPEGRVPWSGHSGKYAA
SQVMAEIAARQTTLVFCNTRGLAELIFQELWSVNDANLPIAIHHGSLSIEARRKVETAMA
AGKLRALVATASLDLGVDWGNVDCVIQMGAPKGSSRLLQRIGRANHRLDMASEAILIPGN
RFEYLEARAALDAVEAGERDADDFRPGALDVLAQHVMAIACAGPFREEELLAEVRSATPY
SALTDEGFAHVLHFIEGGGYALRAYDRFKRLVREADGTWRVSHPKFIQQHRMNAGIIVDQ
PALAVRFANGRKLGTVEEGFAATLRPGDSFFFSGMALEVVRMDTSDLVVRATAKSARIPS
WGGTRMAMSTRLADRVRHFLAEPDAWHRFPDDVREWLEVQRTRSALPQPGQLLVETFPHE
GRHYMVCYSFEGWNAHQSLGMLLTRRMDAQGLMPLGFVSNDYALAVYGLKPVTDPQSLFS
ADILDHEFVDWVEQSSLLKRAFRDVAVISGLIERQHPGKRKTGRQVTFSTDLIYDVLRKY
QPDHLLLKAAWADARARMTDVGRLGDLIDRAASTMLHVPLDRVSPLAVPLLILIGREQVA
QRNAEDALLIEAEALVAEAMRAD