Protein Info for GFF4112 in Xanthobacter sp. DMC5
Annotation: D-apionate oxidoisomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 81% identical to APNO_CUPNN: D-apionate oxidoisomerase (apnO) from Cupriavidus necator (strain ATCC 43291 / DSM 13513 / N-1)
KEGG orthology group: None (inferred from 91% identity to xau:Xaut_2925)MetaCyc: 81% identical to D-apionate oxidoisomerase (Cupriavidus necator N-1)
RXN-20933 [EC: 1.1.1.421]
Predicted SEED Role
"FIG00553873: hypothetical protein"
MetaCyc Pathways
- D-apionate degradation III (RLP transcarboxylase/hydrolase) (3/3 steps found)
- D-apionate degradation II (RLP decarboxylase) (2/5 steps found)
- D-apionate degradation I (xylose isomerase family decarboxylase) (1/5 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.1.1.421
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (276 amino acids)
>GFF4112 D-apionate oxidoisomerase (Xanthobacter sp. DMC5) MDAKIALFGAGGKMGVRLSKNLAKTDFRVAHVEVSEVGRKRLKDEVGVDCIEVDAALDGA DVVILAVPDTLIGKVSHAISPKLKAGTMVMLLDAAAPFAGHLPERPDLIYFVSHPCHPLI FNDETTEEGRRDYFGGVAAKQSITSALMQGPDEAFALGEAVAKAIYAPILRSYRLTVEQM AILEPGLSETICATLLDVMREAMDETVRRGVPAECARDFLLGHMNILAAVTFKEIPGMFS DACNKAIQFGKPRLMRDDWLKCLDNDEIAESIRRIT