Protein Info for GFF4112 in Xanthobacter sp. DMC5

Annotation: D-apionate oxidoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF07991: KARI_N" amino acids 2 to 90 (89 residues), 22.4 bits, see alignment E=1.6e-08 PF03807: F420_oxidored" amino acids 4 to 88 (85 residues), 24.7 bits, see alignment E=5.7e-09 PF03446: NAD_binding_2" amino acids 4 to 90 (87 residues), 23.8 bits, see alignment E=8.2e-09 PF16896: PGDH_C" amino acids 122 to 276 (155 residues), 247.6 bits, see alignment E=9.7e-78

Best Hits

Swiss-Prot: 81% identical to APNO_CUPNN: D-apionate oxidoisomerase (apnO) from Cupriavidus necator (strain ATCC 43291 / DSM 13513 / N-1)

KEGG orthology group: None (inferred from 91% identity to xau:Xaut_2925)

MetaCyc: 81% identical to D-apionate oxidoisomerase (Cupriavidus necator N-1)
RXN-20933 [EC: 1.1.1.421]

Predicted SEED Role

"FIG00553873: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.421

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF4112 D-apionate oxidoisomerase (Xanthobacter sp. DMC5)
MDAKIALFGAGGKMGVRLSKNLAKTDFRVAHVEVSEVGRKRLKDEVGVDCIEVDAALDGA
DVVILAVPDTLIGKVSHAISPKLKAGTMVMLLDAAAPFAGHLPERPDLIYFVSHPCHPLI
FNDETTEEGRRDYFGGVAAKQSITSALMQGPDEAFALGEAVAKAIYAPILRSYRLTVEQM
AILEPGLSETICATLLDVMREAMDETVRRGVPAECARDFLLGHMNILAAVTFKEIPGMFS
DACNKAIQFGKPRLMRDDWLKCLDNDEIAESIRRIT