Protein Info for GFF4112 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF00126: HTH_1" amino acids 12 to 71 (60 residues), 78.7 bits, see alignment E=2.5e-26 PF03466: LysR_substrate" amino acids 97 to 307 (211 residues), 155.9 bits, see alignment E=9.5e-50

Best Hits

Swiss-Prot: 38% identical to TFDS_CUPNJ: HTH-type transcriptional regulator TfdS (tfdS) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: None (inferred from 69% identity to vap:Vapar_2531)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF4112 Transcriptional regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSDALKTLRIELRQWRQFVALAEDLHFGRAAARLHMTQPPLTQAIAGLEQALGVRLFDRT
KRSVALTPAGRALLPEVRDLLGRAQALPELARAAAAGELGRLRLAFVSTVGFELLPRWVR
TFRQRWPQVALELIEATGDVQLELLARGEVDAGMVLHSPGFQAPGLAHARIASEPFVVAL
PESHPLAARDQPGLAALLSEPLVIFPRRILPTLHDAIFALYHAAGRAPQVAQEAIQMQTI
VNLVSAGLGLAWVPQSVRQFQRPGVVYRSPRPSRGRAVPACETSLVWRADALTPALTHFI
EFAREQAGPQ