Protein Info for GFF4110 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Fermentation/respiration switch protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF06500: FrsA-like" amino acids 1 to 414 (414 residues), 781.1 bits, see alignment E=1.1e-239

Best Hits

Swiss-Prot: 100% identical to FRSA_SALPC: Esterase FrsA (frsA) from Salmonella paratyphi C (strain RKS4594)

KEGG orthology group: K11750, esterase FrsA [EC: 3.1.-.-] (inferred from 100% identity to stt:t2532)

Predicted SEED Role

"Fermentation/respiration switch protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>GFF4110 Fermentation/respiration switch protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTQANLSETLFKPRFKHTETSTLVRRFNRGSQPPMQSALDGKNVPHWYRMINRLMWIWRG
VDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWAKQAMDWQQKACQEQDAMR
SGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQRLPGSLREMEFAVPGGSP
VTAFLHMPKGDGPFPTVLMCGGLDAMQTDYYTLYERYFAPRGIAMLTLDMPSVGFSSKWK
LTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVRLAYLEAPRLKAVACLGPVV
HALLSDPQRQSTVPEMYLDVLASRLGMHDASDEALRVELNRYSLKVQGLLGRRCPTPMLS
GFWKNDPFSPEEESRLITTSSSDGKLIEIPFNPVYRNFDRALQEITDWINHRLC