Protein Info for GFF4108 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 63 (27 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 31 to 136 (106 residues), 56.2 bits, see alignment E=2e-19 PF00528: BPD_transp_1" amino acids 54 to 242 (189 residues), 65.7 bits, see alignment E=2.3e-22

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 81% identity to aaa:Acav_2837)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF4108 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MSDPGLLAQAVAAIKPLGLNYAFLLDLGERQAFLRGLLVTLELCLLTIPCSLAAGVAMAA
ALISGHRWLALPARAFVEVTRNTPTLVQLYCAFLVLNMLITRQLEGVGGNPLTPFVWVVI
VVAIHKGAFHAEALRAGIEAVPQVTLEAARSLGFSQRQLLWRVELPLAVRFALPSLVNNL
VDLVKMTAVASAIAVGDVTYESIMIWTQRDNVLELLLLILLYFGALTWLVSRAGSWLEAR
LRMPGYGQ