Protein Info for PS417_21035 in Pseudomonas simiae WCS417

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details PF00892: EamA" amino acids 25 to 155 (131 residues), 98.3 bits, see alignment E=2.3e-32 amino acids 168 to 301 (134 residues), 56.6 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to pfs:PFLU4623)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0B3 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PS417_21035 multidrug transporter (Pseudomonas simiae WCS417)
MSAVLENTAKTKTQKQWLAGLITSVMFLIVCLSWGTTWLGIKIAVESVPPLTSAGLRFLI
AFPLFLCFAMVRREPILFPRESRWFFVFVTLSYFSVPYYLLNYGEMHVSSGLTALLFSCM
PVFILIFSALFLRERIYLSQVVGIGIGFGSLYMIIKSQGLHLDHAEFFGVLAILTAAIMH
ALCYVITKQKGSAISVITYNTLPIGIAGLMLFVAGLWFETPTFEAITLRSWGALFYLGLV
ASVGGFIVYFMLLKRLSPIILSFVFIIFPVFAVIIGAWYEGVSISRDLMLYSAILLAGFA
ITKLPVEKLLAKKN