Protein Info for GFF4105 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 37 to 395 (359 residues), 474 bits, see alignment E=1.7e-146 PF00005: ABC_tran" amino acids 46 to 192 (147 residues), 122.2 bits, see alignment E=2.5e-39

Best Hits

Swiss-Prot: 64% identical to PROV_ECOLI: Glycine betaine/proline betaine transport system ATP-binding protein ProV (proV) from Escherichia coli (strain K12)

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 79% identity to vap:Vapar_2521)

MetaCyc: 64% identical to glycine betaine ABC transporter ATP binding subunit ProV (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.32 or 7.6.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>GFF4105 L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAKHISIEHVFKVFGDQPEAALKRVREGRTKQEILAETGQSIGVFDAHFQIEAGEIFVIM
GLSGSGKSTLVRLLNRLIEPTAGRILIDGQNINDLSDAGLRSLRRKDISMVFQSFALMPH
MTVRDNTAFGLELAGVKPAQRLAQADLALDQVGLAGWGDSYPDELSGGMQQRVGLARALA
SDPSILLMDEAFSALDPIIRTEMQSELVRLQQVRRRTIVFISHDLDEAMRIGDRIAIMKD
GQVVQVGTPEDILRQPADDYVRNFVRGVDAAAVFKAGDIARQTQVVVAEHPNKGARAALK
LLEDKDRDWAYVVSPDQRYLGLVSADSLRGALQDHEGPLGLSRAYLPDVQVVNAGHPVAE
LFGQAANAPYPLPVVDANGRYRGAISKNTLLKFLDRAAA