Protein Info for GFF4103 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: probable exported protein STY0357

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03734: YkuD" amino acids 44 to 159 (116 residues), 32.5 bits, see alignment E=5.9e-12

Best Hits

Swiss-Prot: 91% identical to YAFK_ECOLI: Putative L,D-transpeptidase YafK (yafK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to sea:SeAg_B0346)

MetaCyc: 91% identical to peptidoglycan meso-diaminopimelic acid protein amidase A (Escherichia coli K-12 substr. MG1655)
3.4.-.-; 3.4.-.-

Predicted SEED Role

"probable exported protein STY0357"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF4103 probable exported protein STY0357 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRKIAFFLAMLLMPCVSFAGLLSSSSPVTPVSKEYKQQLMGSPVYIQIFKEERTLDLYVK
MGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKPDSRFYKAINIGFPNA
YDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALVFGQPSVQVSIYPFRMTD
ANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYVVSKPLSHEVVQPQLASNY
TLSEAK