Protein Info for GFF4102 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 253 to 285 (33 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 300 (261 residues), 129.7 bits, see alignment E=5.9e-42

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 57% identity to sfu:Sfum_2142)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF4102 hypothetical protein (Xanthobacter sp. DMC5)
MISPSSPSSARRRALLFWAFFAAGAVVLALAPLALNNYWLRVLTTVFMYATVTQGLNVIV
GLTGYHAFGNAVFFGFGAYACGVAMTLGAPFPVALIAAVAFSALVAGIVGWPILRLRGHY
FAIATVALNLAAIQLVIQVGGVTGGAEGLPLPLSDLPPGPLYRAIYLVMLAGMVVSTLLV
AFILTRPFGYALRAIRDGERAAGVMGIDTTATKVAAWALSAGITGFAGGVWAYWITFIEP
ASAFDPAIGVKAYMMLILGGMGTVIGPVLGAFVLEFLSTLVWGGFLQAHQIVFGVLIVVI
CLVAPNGMLVAGRSLIQRWRSRHGAA