Protein Info for GFF4097 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG00761799: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details amino acids 401 to 420 (20 residues), see Phobius details PF07690: MFS_1" amino acids 54 to 295 (242 residues), 42 bits, see alignment E=8.8e-15 amino acids 269 to 419 (151 residues), 44.6 bits, see alignment E=1.4e-15 PF11700: ATG22" amino acids 61 to 429 (369 residues), 154.9 bits, see alignment E=4.6e-49 PF13347: MFS_2" amino acids 148 to 392 (245 residues), 46.7 bits, see alignment E=2.6e-16

Best Hits

KEGG orthology group: K06902, MFS transporter, UMF1 family (inferred from 76% identity to pol:Bpro_2044)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF4097 FIG00761799: membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAFFSTDALNPGVRKREVFGWAMFDFANSGYTTVVITAVFAAYFVGAVAGGAEWATFAWT
LALSISHLIVMFTIPAMGAWADRHAAKKRLLMMTTLGCVLATVALGLVGPGAVVLGMVLI
VVSNVFFAWGESLVAAFLPELARPEAMGRVSGWGWSLGYVGGMLALGLSLGYVLWAKGQG
QAAEQFVPVTMWITAGVFALAALVTLALLRERAQPQAGPAGAAGWRESLRQLRRTFQQAR
RYRDFMWLLACVAAYQGGVAVAITLAAIYAEQVIGFVQQETMVLIFVLNIAAALGAFAFG
YWQDRLGHKLALGITLVGWVATCIIAALTTTKGGFWYAAAIAGVCMGASQSSGRAMAGML
APPAQLAEFFGLWTFATRVASIIGPLSYGAITWMTGGNQRLAIGFTAVLFVAGLALLMPV
NMQRGRAAALQP