Protein Info for GFF4096 in Sphingobium sp. HT1-2

Annotation: Lipopolysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 253 to 270 (18 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 391 to 409 (19 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details amino acids 453 to 473 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 18 to 284 (267 residues), 81 bits, see alignment E=1e-26 PF13440: Polysacc_synt_3" amino acids 43 to 333 (291 residues), 217.7 bits, see alignment E=2.1e-68

Best Hits

KEGG orthology group: None (inferred from 83% identity to sch:Sphch_2292)

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein WzxC" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>GFF4096 Lipopolysaccharide biosynthesis protein (Sphingobium sp. HT1-2)
MGLQEADAADAGFGARVKKAIFWRSGSQIISQILSWVVTLAVIRLLDPADYGLFAMTQVI
LNFATFLNGYGLVAALVQSETLELHRLRQAFTIMLLLNGSLALLQLAIAPLAADYYDQPM
VAQLLRVQALLYLSTPFIAIPEAITARALDFRRPAFINLIAAIASAAMALVGALSGWGVW
TLVFAPMTGFWVKALGYMLVTGFRPIPSFDFTGTRAMILYGASLLGSQLFWIIQSQSDIF
IGGRVLTPHQLGLYAEALFLTQIFVSKFIPPLNEVAFPAYARMQKDVSRVAWSFCKAVRL
LMLISCPIYLGMAVTAEPLVETLFGQKWLEMAPFVSILALAMPFMTLQVMFAPVSNALGR
PGTTARIAAIGAILMATAFLIGIQWGAIGLAWAWLGAFPILTIVTARLAGGPMGLRAIDL
IRAAAPGLGCAILMAGVVLVIDRLLPPLAAPIRLAILVPAGGIAFLAALMLCARGTLMEL
VRLIVRRAPPVQAPA