Protein Info for GFF4094 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 112 to 281 (170 residues), 42.2 bits, see alignment E=3.9e-15

Best Hits

KEGG orthology group: None (inferred from 62% identity to azl:AZL_b02470)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>GFF4094 hypothetical protein (Xanthobacter sp. DMC5)
MAEITPLPVARLSPPIRPEFERTTPPVSDAAEIERPLSLWEHLANMEGVRRGAIVVALMV
AWQVYAVWLSNPLMFPTLTDTLSALWDGLVHGVLLQRIGATLQVLMTGYAIGIALAAMLT
TFAVSSRLGADLLATLTAMFNPLPAIALLPLALLWFGLGVPSLVFVIVHSVLWAVALNTL
TGFLGVSETQRLAGQNYGLRGVRYVALILIPAAFPSILSGLKIGWAFAWRTLIAAELVFG
VSSRSGGLGWFLFEKRNQLETDQVFAGLTCVIIIGLLVEGLIFRTIEARTIRRWGMSRG