Protein Info for PS417_20960 in Pseudomonas simiae WCS417

Updated annotation (from data): Nitrate-binding regulatory protein (nasS)
Rationale: This protein is specifically important for the utilization of nitrate as a nitrogen source, but this may be a polar effect. It is74% identical to the nasS/PA1786 protein from P. aeruginosa (PMID:22493305) and to nasS from Azotobacter vinelandii (PMID:8748040), which binds nitrate and suppresses the activity of the transcriptional activator nasT. It is also more distantly related to the periplasmic substrate-binding components of nitrate ABC transporters (i.e., 37% identity to the N terminal part of ntrC/sll1452 and 36% identity to ntrA/sll1450), hence the misannotation as a transporter.
Original annotation: nitrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF13379: NMT1_2" amino acids 21 to 272 (252 residues), 313.6 bits, see alignment E=6.7e-98

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 96% identity to pfs:PFLU4607)

Predicted SEED Role

"Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2J4 at UniProt or InterPro

Protein Sequence (408 amino acids)

>PS417_20960 Nitrate-binding regulatory protein (nasS) (Pseudomonas simiae WCS417)
MNDSDGNSPMNDPLAWVNGSDAPEKSSLDLGFMALSDCASMVVAATQGFAQPYGLTLNLK
RQTSWANLRDKLVSGELDAAHSLYGLIYAVHLGIGGVAPTDMAVLMGLNQNGQSINLSRG
LQQQGVITPEALDRHVHQSRTKLTFAQTFPTGTHAMWLYYWLASQGIHPLQDVDSVVVPP
PQMVAHLQAGRIDGFCVGEPWCASAVKQNQGFTLATTQAIWPDHPEKVLGCTQAFVDQYP
NTARVLVMAILEASRFIEESSENRRSTAQLLSGREYLDAPLDCIEPRLLGTYDDGLGNHW
QDPHALRFFADGEVNLPYLSDGMWFMTQFRRWGLLREDPDYLGVARQVQQLPLYRQAAAA
LGIATKHPDMRSSQLIDGKVWDGSDPADYARSFRLHALADTTHRQALR