Protein Info for GFF4089 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 179 to 205 (27 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details PF01311: Bac_export_1" amino acids 16 to 247 (232 residues), 190.1 bits, see alignment E=2.4e-60 TIGR01400: flagellar biosynthetic protein FliR" amino acids 17 to 257 (241 residues), 184.5 bits, see alignment E=1.3e-58

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 52% identity to cvi:CV_3005)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF4089 Flagellar biosynthesis protein FliR (Hydrogenophaga sp. GW460-11-11-14-LB1)
VNPMEPVFGQLLATLLAMWWPFVRLLAMLSFMPVVGENMVPVTVRVLLALALAVVLLPVA
QPPVPITPFSMLGILTTIEQVVIGLVIGLSFQLIMAVFTLLGFMASSQMGLSMAVMNDPM
SGVSSDVVSTLLYIMSILVFFAVEGHLVFNGVMGSSFKSWPVGGGIPQVALETLPLQVAW
IFSAALLLALPVIFSALVVQIGFGFLNRIAPAFNLFSLGFSLIIVFGLFMLSGLVRYIPE
QYVRLTTRVLGMLEQMMAAR