Protein Info for GFF4086 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 250 (170 residues), 99.3 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: None (inferred from 61% identity to vei:Veis_0765)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>GFF4086 hypothetical protein (Xanthobacter sp. DMC5)
MPLGRRSAIGVTTLGLLVLAWFMATGANGLISPGRFPTPADTWTAGLQAMVRGYGDATLV
VHVLQSLKLVALGFVVSVAVGVPLGLLMGTSATAEAVLNPVFMLLRPIPPLAWIPLAILW
FGLGDTAKIMVIFFAAFVPSVINTQAGVRTIERPLIEAARMLGTPQGRFIREVVVPGAAP
MIFTGLRLSLQASWTTLVAAELVGALAGLGHLLNLAQQDLYPGMILVGMICVAIFGALTT
ALLGLVERRTLTWVRIKGDTA