Protein Info for GFF4084 in Xanthobacter sp. DMC5

Annotation: Nitrate import ATP-binding protein NrtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00005: ABC_tran" amino acids 21 to 160 (140 residues), 103.6 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 46% identical to TAUB3_PARXL: Taurine import ATP-binding protein TauB 3 (tauB3) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 67% identity to axy:AXYL_01405)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF4084 Nitrate import ATP-binding protein NrtD (Xanthobacter sp. DMC5)
MSSIRFDAVSKSFGAGQVKALDDVDLAIADKEFLAIVGPSGCGKTTCLRLAAGFEFPTSG
RVLVGNAEVREPGPDRAVVFQQFALFPWKTVVENIELGLRNRNMPREERRIRVMEAVELI
GLNGYEGAYPHQLSGGMQQRVAIARAYVLDPQVLLMDEPFGALDAQTRVVMQEELVRLAR
RNPRTVLFITHGVEEAVYLADRVAIMTRRPGRLKEIVDVKSIREAEGWERYSRIEDVMDL
ESFVHLRTHIWRSLREEKTGAAH