Protein Info for GFF4084 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ubiquinone/menaquinone biosynthesis methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF01209: Ubie_methyltran" amino acids 16 to 153 (138 residues), 68.8 bits, see alignment E=1.4e-22 PF13489: Methyltransf_23" amino acids 35 to 147 (113 residues), 27 bits, see alignment E=1e-09 PF13847: Methyltransf_31" amino acids 43 to 146 (104 residues), 43.2 bits, see alignment E=1e-14 PF13649: Methyltransf_25" amino acids 44 to 138 (95 residues), 76.7 bits, see alignment E=5.7e-25 PF08241: Methyltransf_11" amino acids 45 to 142 (98 residues), 74 bits, see alignment E=3.8e-24 PF08242: Methyltransf_12" amino acids 45 to 139 (95 residues), 51.7 bits, see alignment E=3.8e-17

Best Hits

KEGG orthology group: None (inferred from 79% identity to vap:Vapar_6259)

Predicted SEED Role

"ubiquinone/menaquinone biosynthesis methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>GFF4084 ubiquinone/menaquinone biosynthesis methyltransferase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MADTHTVFAGSIPKFYDSLMVPMIFAAYAEHMAERVAAFSPGTVLETAAGTGVVTRALAP
RLGAQARYVVTDLNQPMLDHAAARQGADARIEWQQADALHLPFTAGSFDVVCCQFGVMFF
PDRVAGYAEARRVLRPGGHWVFSVWDRIENNAFADEVTNAVATVFPDDPPRFPALIPHGY
HDVTRIRDELVQAGFTDIRIETREEVSHAASARDAATAYCQGTPLRNEIEARDAGLLQFA
TDRATEAIASRHGDGPVAGKIQAHVVVATSAGAPTRVSPAAP