Protein Info for GFF4082 in Xanthobacter sp. DMC5

Annotation: Sulfopropanediol 3-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 161 to 189 (29 residues), see Phobius details PF00815: Histidinol_dh" amino acids 13 to 420 (408 residues), 429.3 bits, see alignment E=8.3e-133 TIGR00069: histidinol dehydrogenase" amino acids 24 to 415 (392 residues), 417.1 bits, see alignment E=4.3e-129

Best Hits

Swiss-Prot: 75% identical to HPSN_CUPNJ: Sulfopropanediol 3-dehydrogenase (hpsN) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 75% identity to reu:Reut_C6092)

MetaCyc: 75% identical to sulfopropanediol 3-dehydrogenase monomer (Cupriavidus pinatubonensis JMP134)
RXN-11727 [EC: 1.1.1.308]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.23

Use Curated BLAST to search for 1.1.1.23 or 1.1.1.308

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF4082 Sulfopropanediol 3-dehydrogenase (Xanthobacter sp. DMC5)
MAIEYLKRASKTPETETGTAREVVTAMLGEIERRGEEAVRDYALKLDKWDGPILVTREEM
ERRAREVPDQVRRDIAFAADQVRRFADAQRESVKDFSVELLPGLTAGQKLVPCNVAGCYV
PTGRYAHIASAYMSVATAKAAGVGTVVACSTPYRGGGIHPYVLYAMMVAGADVVMTLGGV
QAIAAMAYGLFTGKPADIIVGPGNKFVAEAKRMLFGKVGIDVFAGPSEVAVIADETADPL
MVAVDLVGQAEHGHESPAWLFTSSRALADEVMRAVPGLIADLPPTARDAAAAAWRDYGEV
IVCDTREELVEVSDRYASEHLEVHAADLGWWREALTNYGSLFLGEETTVAFGDKTSGPNH
ILPTKFAARYSAGLSVHKFLKPLTWQQMSRDACKTIAQVTARISRLEGMEAHARTGDYRL
AKYFPGHNFDMGVPVDA