Protein Info for GFF4081 in Variovorax sp. SCN45

Annotation: Multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 81 to 107 (27 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details PF14342: DUF4396" amino acids 77 to 214 (138 residues), 124.8 bits, see alignment E=7e-40 PF07732: Cu-oxidase_3" amino acids 407 to 517 (111 residues), 128.3 bits, see alignment E=3.4e-41 PF00394: Cu-oxidase" amino acids 527 to 653 (127 residues), 51 bits, see alignment E=3.7e-17 PF07731: Cu-oxidase_2" amino acids 550 to 652 (103 residues), 66.1 bits, see alignment E=5.7e-22

Best Hits

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (671 amino acids)

>GFF4081 Multicopper oxidase (Variovorax sp. SCN45)
MLIQPIDYFLAVWFVLAALSTAYVAWDQLRHNPEPLVMKWGFILVTLYLGPLGLLLYVMA
DKEPAPGAHEEFVKPLWKQGVGSTIHCVAGDATGIILAAVVTAMLGLPMWVDLIVEYVAG
FAFGLFIFQSLFMKNMMGGTYLENVKKSFMPEFISMNAMMAGMAPTMALLMMGRDMRAMD
PTELVFWGVMSLGVAVGFAVAYPVNVWMVSRKMKHGLMTERRPEKATGGPSDMPAKGDHG
IAAMATAAHGTPTNTGHGGHGAHAGHEEGSLPEKAPTDAPVGHAHGTQPGQDGQGGRNGH
GMRPNVTRPQLAAVTMTTTLMLLAGMTMPAMFVNMRLSNRDVRGAIMPPSMIMGWDTPGD
AMRDMSAIHPRLVTQAAAAQARGDVDLVPTLDNGVKVFNLETSVIRWNILPDVTVEGYAF
NATIPGPRIRVTEGDRVRIKVTNRLPESTTVHWHGLILPNEMDGPAKITQKPIQPGDSYT
YEFTTEQAGTFFYHTHDHVDRQQAFGLYGALIIDPRSPQEAPKADHEYVLQLQEWLKREG
LTYPAMLMEGGLPNYFTINGKAFPATDTVKMKVGETIKLRFVGSNNNFVHPMHVHGGPFT
VVARDGYVLPESARFQADTVNVGPGQRYDVIWKALRPGKWLVHCHIPHHTTNNNVEQDGG
GGLMMVLEVEA